(data stored in SCRATCH3701 zone)

EMBL: CP001396.YAFD

CP001396.YAFD        Location/Qualifiers
FT   CDS             231121..231921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="BWG_0196"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0209"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62429"
FT                   /db_xref="GOA:C4ZRU6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZRU6"
FT                   /protein_id="ACR62429.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIR
FT                   ILVWNIYKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
     MRKNTYAMRY VAGQPAERIL PPGSFASIGQ ALPPGEPLST EERIRILVWN IYKQQRAEWL        60
     SVLKNYGKDA HLVLLQEAQT TPELVQFATA NYLAADQVPA FVLPQHPSGV MTLSAAHPVY       120
     CCPLREREPI LRLAKSALVT VYPLPDTRLL MVVNIHAVNF SLGVDVYSKQ LLPIGDQIAH       180
     HSGPVIMAGD FNAWSRRRMN ALYRFAREMS LRQVRFTDDQ RRRAFGRPLD FVFYRGLNVS       240
     EASVLVTRAS DHNPLLVEFS PGKPDK                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page