(data stored in SCRATCH3701 zone)

EMBL: CP001396.YAIL

CP001396.YAIL        Location/Qualifiers
FT   CDS             278755..279294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="BWG_0243"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /note="MG1655 equivalent: b0354"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63917"
FT                   /protein_id="ACR63917.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
     MAKLTLQEQL LKAGLVTSKK AAKVERTAKK SRVQAREARA AVEENKKAQL ERDKQLSEQQ        60
     KQAALAKEYK AQVKQLIEMN RITIANGDIG FNFTDGNLIK KIFVDKLTQA QLINGRLAIA       120
     RLLVDNNSEG EYAIIPASVA DKIAQRDASS IVLHSALSAE EQDEDDPYAD FKVPDDLMW        179
//

If you have problems or comments...

PBIL Back to PBIL home page