(data stored in SCRATCH3701 zone)

EMBL: CP001396.YAIY

CP001396.YAIY        Location/Qualifiers
FT   CDS             complement(301008..301316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="BWG_0263"
FT                   /product="predicted inner membrane protein"
FT                   /note="MG1655 equivalent: b0379"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64493"
FT                   /protein_id="ACR64493.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
     MADFTLSKSL FSGKYRNASS TPGNIAYALF VLFCFWAGAQ LLNLLVHAPG VYERLMQVQE        60
     TGRPRVEIGL GVGTIFGLIP FLVGCLIFAV VALWLHWRHR RQ                          102
//

If you have problems or comments...

PBIL Back to PBIL home page