(data stored in SCRATCH3701 zone)

EMBL: CP001396.YAJD

CP001396.YAJD        Location/Qualifiers
FT   CDS             332588..332935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="BWG_0292"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0410"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62435"
FT                   /protein_id="ACR62435.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     MAIIPKNYAR LESGYREKAL KIYPWVCGRC SREFVYSNLR ELTVHHIDHD HTNNPEDGSN        60
     WELLCLYCHD HEHSKYTEAD QYGTTVIAGE DAQKDVGEAK YNPFADLKAM MNKKK            115
//

If you have problems or comments...

PBIL Back to PBIL home page