(data stored in SCRATCH3701 zone)

EMBL: CP001396.YAJQ

CP001396.YAJQ        Location/Qualifiers
FT   CDS             346666..347157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="BWG_0308"
FT                   /product="predicted nucleotide binding protein"
FT                   /note="MG1655 equivalent: b0426"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64695"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZTI3"
FT                   /protein_id="ACR64695.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
     MPSFDIVSEV DLQEARNAVD NASREVESRF DFRNVEASFE LNDASKTIKV LSESDFQVNQ        60
     LLDILRAKLL KRGIEGSSLD VPENIVHSGK TWFVEAKLKQ GIESATQKKI VKMIKDSKLK       120
     VQAQIQGDEI RVTGKSRDDL QAVMAMVRGG DLGQPFQFKN FRD                         163
//

If you have problems or comments...

PBIL Back to PBIL home page