(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBCI

CP001396.YBCI        Location/Qualifiers
FT   CDS             complement(458015..458536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="BWG_0402"
FT                   /product="conserved inner membrane protein"
FT                   /note="MG1655 equivalent: b0527"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62174"
FT                   /protein_id="ACR62174.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   KFGVAYGNVFGHRGFTHSLVFAFVVPLLCVFIGRRWFRAGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTPYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
     MPTVITHAAV PLCIGLGLGS KVIPPRLLFA GIILAMLPDA DVLSFKFGVA YGNVFGHRGF        60
     THSLVFAFVV PLLCVFIGRR WFRAGLIRCW LFLTVSLLSH SLLDSVTTGG KGVGWLWPWS       120
     DERFFAPWQV IKVAPFALSR YTTPYGHQVI ISELMWVWLP GMLLMGMLWW RRR              173
//

If you have problems or comments...

PBIL Back to PBIL home page