(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBCN

CP001396.YBCN        Location/Qualifiers
FT   CDS             474449..474904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcN"
FT                   /locus_tag="BWG_0419"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /note="MG1655 equivalent: b0547"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62801"
FT                   /protein_id="ACR62801.1"
FT                   /translation="MNLSQDGIKLHRGNFTAIGRQIQPYLEEGKCFRMVLKPWREKRSL
FT                   SQNALSHMWYSEISEYLISRGKTFATPAWVKDALKHTYLGYETKDLVDVVTGDITTIQS
FT                   LRHTSDLDTGEMYVFLCKVEAWAMNIGCHLTIPQSCEFQLLRDKQEA"
     MNLSQDGIKL HRGNFTAIGR QIQPYLEEGK CFRMVLKPWR EKRSLSQNAL SHMWYSEISE        60
     YLISRGKTFA TPAWVKDALK HTYLGYETKD LVDVVTGDIT TIQSLRHTSD LDTGEMYVFL       120
     CKVEAWAMNI GCHLTIPQSC EFQLLRDKQE A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page