(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBCO

CP001396.YBCO        Location/Qualifiers
FT   CDS             475067..475357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcO"
FT                   /locus_tag="BWG_0421"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /note="MG1655 equivalent: b0549"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62802"
FT                   /protein_id="ACR62802.1"
FT                   /translation="MADLRKAARGRECQVRIPGVCNGNPETSVLAHIRLTGLCGTGTKP
FT                   PDLIATIACSACHDEIDRRTHFVDAGYAKECALEGMARTQVIWLKEGVIKA"
     MADLRKAARG RECQVRIPGV CNGNPETSVL AHIRLTGLCG TGTKPPDLIA TIACSACHDE        60
     IDRRTHFVDA GYAKECALEG MARTQVIWLK EGVIKA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page