(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBCW

CP001396.YBCW        Location/Qualifiers
FT   CDS             481863..482069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcW"
FT                   /locus_tag="BWG_0432"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /note="MG1655 equivalent: b0559"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62803"
FT                   /protein_id="ACR62803.1"
FT                   /translation="MNKEQSADDPSVDLIRVKNMLNSTISMSYPDVVIACIEHKVSLEA
FT                   FRAIEAALVKHDNNMKDYSLVVD"
     MNKEQSADDP SVDLIRVKNM LNSTISMSYP DVVIACIEHK VSLEAFRAIE AALVKHDNNM        60
     KDYSLVVD                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page