(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBDB

CP001396.YBDB        Location/Qualifiers
FT   CDS             531283..531696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdB"
FT                   /locus_tag="BWG_0470"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0597"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62442"
FT                   /protein_id="ACR62442.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG"
     MIWKRHLTLD ELNATSDNTM VAHLGIVYTR LGDDVLEAEM PVDTRTHQPF GLLHGGASAA        60
     LAETLGSMAG FMMTRDGQCV VGTELNATHH RPVSEGKVRG VCQPLHLGRQ NQSWEIVVFD       120
     EQGRRCCTCR LGTAVLG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page