(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBEL

CP001396.YBEL        Location/Qualifiers
FT   CDS             577001..577483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="BWG_0514"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0643"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62443"
FT                   /protein_id="ACR62443.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
     MNKVAQYYRE LVASLSERLR NGERDIDALV EQARERVIKT GELTRTEVDE LTRAVRRDLE        60
     EFAMSYEESL KEESDSVFMR VIKESLWQEL ADITDKTQLE WREVFQDLNH HGVYHSGEVV       120
     GLGNLVCEKC HFHLPIYTPE VLTLCPKCGH DQFQRRPFEP                             160
//

If you have problems or comments...

PBIL Back to PBIL home page