(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBET

CP001396.YBET        Location/Qualifiers
FT   CDS             complement(580835..581389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeT"
FT                   /locus_tag="BWG_0518"
FT                   /product="conserved outer membrane protein"
FT                   /note="MG1655 equivalent: b0647"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62257"
FT                   /protein_id="ACR62257.1"
FT                   /translation="MNKKLMYIFAIFIVAAITCISQPKKTTLRDKAMVNYAFDYLSSPG
FT                   SLPFTTAATELSAIHGHSTSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQENPRAQS
FT                   KLGWIYLKGLGVKPDTRKAILWYKEAAEQGYAHAQYTLGLIYRNGSGINVNHYESQKWL
FT                   KLTAKQHYKNAERLLAGLPAH"
     MNKKLMYIFA IFIVAAITCI SQPKKTTLRD KAMVNYAFDY LSSPGSLPFT TAATELSAIH        60
     GHSTSQYRLG EFYLHGSDGK PLDYTQARYW YEQSAEQENP RAQSKLGWIY LKGLGVKPDT       120
     RKAILWYKEA AEQGYAHAQY TLGLIYRNGS GINVNHYESQ KWLKLTAKQH YKNAERLLAG       180
     LPAH                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page