(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBFB

CP001396.YBFB        Location/Qualifiers
FT   CDS             635759..636085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /locus_tag="BWG_0562"
FT                   /product="predicted inner membrane protein"
FT                   /note="MG1655 equivalent: b0702"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64534"
FT                   /protein_id="ACR64534.1"
FT                   /translation="MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSY
FT                   GMMVICFPTGIVFFIALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKR
FT                   IINK"
     MKYIIFLFRA IWLALSLLIL FFSMHRLSLL DSTRDVSELI SLMSYGMMVI CFPTGIVFFI        60
     ALIFIGTVSD IIGVRIDSKY IMAIIIWLYF LSGGYIQWFV LSKRIINK                    108
//

If you have problems or comments...

PBIL Back to PBIL home page