(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBFK

CP001396.YBFK        Location/Qualifiers
FT   CDS             622566..622823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfK"
FT                   /locus_tag="BWG_0553"
FT                   /product="hypothetical protein"
FT                   /note="MG1655 equivalent: b4590"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63484"
FT                   /protein_id="ACR63484.1"
FT                   /translation="MQKPLPVRWLIIQGLTENEHCGIQAYACNTESQEDLYAEVPLVGR
FT                   LTGIEEVKVEAIAMSKLHNMSCPPYMGHSAAVIFHLIYLS"
     MQKPLPVRWL IIQGLTENEH CGIQAYACNT ESQEDLYAEV PLVGRLTGIE EVKVEAIAMS        60
     KLHNMSCPPY MGHSAAVIFH LIYLS                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page