(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBGF

CP001396.YBGF        Location/Qualifiers
FT   CDS             681581..682372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="BWG_0601"
FT                   /product="predicted protein"
FT                   /note="MG1655 equivalent: b0742"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64955"
FT                   /protein_id="ACR64955.1"
FT                   /translation="MSSNFRHQLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQL
FT                   ERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSG
FT                   GAAAQSTSGDQSGAAASTTPTADAGTANAGAPVKSGNANTDYNAAIALVQDKSRQDDAM
FT                   VAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFK
FT                   VGVIMQDKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM"
     MSSNFRHQLL SLSLLVGIAA PWAAFAQAPI SSVGSGSVED RVTQLERISN AHSQLLTQLQ        60
     QQLSDNQSDI DSLRGQIQEN QYQLNQVVER QKQILLQIDS LSSGGAAAQS TSGDQSGAAA       120
     STTPTADAGT ANAGAPVKSG NANTDYNAAI ALVQDKSRQD DAMVAFQNFI KNYPDSTYLP       180
     NANYWLGQLN YNKGKKDDAA YYFASVVKNY PKSPKAADAM FKVGVIMQDK GDTAKAKAVY       240
     QQVISKYPGT DGAKQAQKRL NAM                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page