(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBGJ

CP001396.YBGJ        Location/Qualifiers
FT   CDS             645576..646232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgJ"
FT                   /locus_tag="BWG_0570"
FT                   /product="predicted enzyme subunit"
FT                   /note="MG1655 equivalent: b0711"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64366"
FT                   /protein_id="ACR64366.1"
FT                   /translation="MQRARCYLIGETAVVLELEPPVTLASQKRIWRLAQRLVDMPNVVE
FT                   AIPGMNNITVILRNPESLALDAIERLQRWWEESEALEPESRFIEIPVVYGGAGGPDLAV
FT                   VAAHCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEPRLLVPAGSV
FT                   GIGGPQTGVYPLATPGGWQLIGHTSLSLFDPARDEPILLRPGDSVRFVPQKEGVC"
     MQRARCYLIG ETAVVLELEP PVTLASQKRI WRLAQRLVDM PNVVEAIPGM NNITVILRNP        60
     ESLALDAIER LQRWWEESEA LEPESRFIEI PVVYGGAGGP DLAVVAAHCG LSEKQVVELH       120
     SSVEYVVWFL GFQPGFPYLG SLPEQLHTPR RAEPRLLVPA GSVGIGGPQT GVYPLATPGG       180
     WQLIGHTSLS LFDPARDEPI LLRPGDSVRF VPQKEGVC                               218
//

If you have problems or comments...

PBIL Back to PBIL home page