(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBGP

CP001396.YBGP        Location/Qualifiers
FT   CDS             complement(650962..651690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgP"
FT                   /locus_tag="BWG_0576"
FT                   /product="predicted assembly protein"
FT                   /note="MG1655 equivalent: b0717"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64167"
FT                   /protein_id="ACR64167.1"
FT                   /translation="MTFIKGLPLMLLTISLGCNAAVQPDRTRIVFNANDKATSLRIENQ
FT                   SDKLPYLAYSWIENEKGEKSDALLVALPPIQRLEPKATSQVRVVKQASTTQLPGDRETL
FT                   FFYNMREIPPAPDKSSDHAILQVAIQSRIKLFWRPAALRKKAGEKVELQLQVSQQGNQL
FT                   TLKNPTAYYLTIAYLGRNEKGVLPGFKTVMVAPFSTVNTNTGSYSGSQFYLGYMDDYGA
FT                   LRMTTLNCSGQCRLQAVEAK"
     MTFIKGLPLM LLTISLGCNA AVQPDRTRIV FNANDKATSL RIENQSDKLP YLAYSWIENE        60
     KGEKSDALLV ALPPIQRLEP KATSQVRVVK QASTTQLPGD RETLFFYNMR EIPPAPDKSS       120
     DHAILQVAIQ SRIKLFWRPA ALRKKAGEKV ELQLQVSQQG NQLTLKNPTA YYLTIAYLGR       180
     NEKGVLPGFK TVMVAPFSTV NTNTGSYSGS QFYLGYMDDY GALRMTTLNC SGQCRLQAVE       240
     AK                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page