(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBHN

CP001396.YBHN        Location/Qualifiers
FT   CDS             complement(723733..724689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhN"
FT                   /locus_tag="BWG_0641"
FT                   /product="conserved inner membrane protein"
FT                   /note="MG1655 equivalent: b0788"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62175"
FT                   /protein_id="ACR62175.1"
FT                   /translation="MSKSHPRWRLAKKILTWLFFIAVIVLLVVYAKKVDWEEVWKVIRD
FT                   YNRVALLSAVGLVVVSYLIYGCYDLLARFYCGHKLAKRQVMLVSFICYAFNLTLSTWVG
FT                   GIGMRYRLYSRLGLPGSTITRIFSLSITTNWLGYILLAGIIFTAGVVELPDHWYVDQTT
FT                   LRILGIGLLMIIAVYLWFCAFAKHRHMTIKGQKLVLPSWKFALAQMLISSVNWMVMGAI
FT                   IWLLLGQSVNYFFVLGVLLVSSIAGVIVHIPAGIGVLEAVFIALLAGEHTSKGTIIAAL
FT                   LAYRVLYYFIPLLLALICYLLLESQAKKLRAKNEAAM"
     MSKSHPRWRL AKKILTWLFF IAVIVLLVVY AKKVDWEEVW KVIRDYNRVA LLSAVGLVVV        60
     SYLIYGCYDL LARFYCGHKL AKRQVMLVSF ICYAFNLTLS TWVGGIGMRY RLYSRLGLPG       120
     STITRIFSLS ITTNWLGYIL LAGIIFTAGV VELPDHWYVD QTTLRILGIG LLMIIAVYLW       180
     FCAFAKHRHM TIKGQKLVLP SWKFALAQML ISSVNWMVMG AIIWLLLGQS VNYFFVLGVL       240
     LVSSIAGVIV HIPAGIGVLE AVFIALLAGE HTSKGTIIAA LLAYRVLYYF IPLLLALICY       300
     LLLESQAKKL RAKNEAAM                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page