(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBIA

CP001396.YBIA        Location/Qualifiers
FT   CDS             complement(734659..735141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiA"
FT                   /locus_tag="BWG_0651"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0798"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62284"
FT                   /protein_id="ACR62284.1"
FT                   /translation="MPVRAQRIQHVMQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWP
FT                   TSEHYFQAQKFLDEKYREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAK
FT                   FEQHAELRALLLATAPAKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQLAIEK"
     MPVRAQRIQH VMQDTIINFY STSDDYGDFS NFAAWPIKVD GKTWPTSEHY FQAQKFLDEK        60
     YREEIRRVSS PMVAARMGRD RSKPLRKNWE SVKEQVMRKA LRAKFEQHAE LRALLLATAP       120
     AKLVEHTEND AYWGDGGHGK GKNRLGYLLM ELREQLAIEK                             160
//

If you have problems or comments...

PBIL Back to PBIL home page