(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBIM

CP001396.YBIM        Location/Qualifiers
FT   CDS             complement(743987..744247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiM"
FT                   /locus_tag="BWG_0659"
FT                   /product="predicted protein"
FT                   /note="MG1655 equivalent: b0806"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64850"
FT                   /protein_id="ACR64850.1"
FT                   /translation="MKKCLTLLIATVLSGISLTAYAAQPMSNLDSGQLRPAGTVSATGA
FT                   SNLSDLEDKLAEKAREQGAKGYVINSAGGNDQMFGTATIYK"
     MKKCLTLLIA TVLSGISLTA YAAQPMSNLD SGQLRPAGTV SATGASNLSD LEDKLAEKAR        60
     EQGAKGYVIN SAGGNDQMFG TATIYK                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page