(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBIS

CP001396.YBIS        Location/Qualifiers
FT   CDS             complement(757015..757935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiS"
FT                   /locus_tag="BWG_0672"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0819"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62287"
FT                   /protein_id="ACR62287.1"
FT                   /translation="MNMKLKTLFAAAFAVVGFCSTASAVTYPLPTDGSRLVGQNQVITI
FT                   PEGNTQPLEYFAAEYQMGLSNMMEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIVIN
FT                   SAEMRLYYYPKGTNTVIVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRA
FT                   AGEPLPAVVPAGPDNPMGLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNEDIKFLF
FT                   EKVPVGTRVQFIDEPVKATTEPDGSRYIEVHNPLSTTEAQFEGQEIVPITLTKSVQTVT
FT                   GQPDVDQVVLDEAIKNRSGMPVRLN"
     MNMKLKTLFA AAFAVVGFCS TASAVTYPLP TDGSRLVGQN QVITIPEGNT QPLEYFAAEY        60
     QMGLSNMMEA NPGVDTFLPK GGTVLNIPQQ LILPDTVHEG IVINSAEMRL YYYPKGTNTV       120
     IVLPIGIGQL GKDTPINWTT KVERKKAGPT WTPTAKMHAE YRAAGEPLPA VVPAGPDNPM       180
     GLYALYIGRL YAIHGTNANF GIGLRVSHGC VRLRNEDIKF LFEKVPVGTR VQFIDEPVKA       240
     TTEPDGSRYI EVHNPLSTTE AQFEGQEIVP ITLTKSVQTV TGQPDVDQVV LDEAIKNRSG       300
     MPVRLN                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page