(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBIU

CP001396.YBIU        Location/Qualifiers
FT   CDS             complement(759987..761252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiU"
FT                   /locus_tag="BWG_0674"
FT                   /product="predicted protein"
FT                   /note="MG1655 equivalent: b0821"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64851"
FT                   /protein_id="ACR64851.1"
FT                   /translation="MASTFTSDTLPADHKAAIRQMKHALRAQLGDVQQIFNQLSDDIAT
FT                   RVAEINALKAQGDAVWPVLSYADIKAGHVTAEQREQIKRRGCAVIKGHFPREQALGWDQ
FT                   SMLDYLDRNRFDEVYKGPGDNFFGTLSASRPEIYPIYWSQAQMQARQSEEMANAQSFLN
FT                   RLWTFESDGKQWFNPDVSVIYPDRIRRRPPGTTSKGLGAHTDSGALERWLLPAYQRVFA
FT                   NVFNGNLAQYDPWHAAHRTEVEEYTVDNTTKCSVFRTFQGWTALSDMLPGQGLLHVVPI
FT                   PEAMAYVLLRPLLDDVPEDELCGVAPGRVLPVSEQWHPLLIEALTSIPKLEAGDSVWWH
FT                   CDVIHSVAPVENQQGWGNVMYIPAAPMCEKNLAYAHKVKAALEKGASPGDFPREDYETN
FT                   WEGRFTLADLNIHGKRALGMDV"
     MASTFTSDTL PADHKAAIRQ MKHALRAQLG DVQQIFNQLS DDIATRVAEI NALKAQGDAV        60
     WPVLSYADIK AGHVTAEQRE QIKRRGCAVI KGHFPREQAL GWDQSMLDYL DRNRFDEVYK       120
     GPGDNFFGTL SASRPEIYPI YWSQAQMQAR QSEEMANAQS FLNRLWTFES DGKQWFNPDV       180
     SVIYPDRIRR RPPGTTSKGL GAHTDSGALE RWLLPAYQRV FANVFNGNLA QYDPWHAAHR       240
     TEVEEYTVDN TTKCSVFRTF QGWTALSDML PGQGLLHVVP IPEAMAYVLL RPLLDDVPED       300
     ELCGVAPGRV LPVSEQWHPL LIEALTSIPK LEAGDSVWWH CDVIHSVAPV ENQQGWGNVM       360
     YIPAAPMCEK NLAYAHKVKA ALEKGASPGD FPREDYETNW EGRFTLADLN IHGKRALGMD       420
     V                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page