(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBJO

CP001396.YBJO        Location/Qualifiers
FT   CDS             800180..800668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjO"
FT                   /locus_tag="BWG_0711"
FT                   /product="predicted inner membrane protein"
FT                   /note="MG1655 equivalent: b0858"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64539"
FT                   /protein_id="ACR64539.1"
FT                   /translation="MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFN
FT                   TLGVRGIGEFIHRSVQTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITA
FT                   ASYLWAASLGYGYPELFSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ"
     MEDETLGFFK KTSSSHARLN VPALVQVAAL AIIMIRGLDV LMIFNTLGVR GIGEFIHRSV        60
     QTWSLTLVFL SSLVLVFIEI WCAFSLVKGR RWARWLYLLT QITAASYLWA ASLGYGYPEL       120
     FSIPGESKRE IFHSLMLQKL PDMLILMLLF VPSTSRRFFQ LQ                          162
//

If you have problems or comments...

PBIL Back to PBIL home page