(data stored in SCRATCH3701 zone)

EMBL: CP001396.YLBA

CP001396.YLBA        Location/Qualifiers
FT   CDS             complement(445244..446029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="BWG_0391"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0515"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62274"
FT                   /protein_id="ACR62274.1"
FT                   /translation="MGYLNNVTGYREDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFALS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGYAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
     MGYLNNVTGY REDLLANRAI VKHGNFALLT PDGLVKNIIP GFENCDATIL STPKLGASFV        60
     DYLVTLHQNG GNQQGFGGEG IETFLYVISG NITAKAEGKT FALSEGGYLY CPPGSLMTFV       120
     NAQAEDSQIF LYKRRYVPVE GYAPWLVSGN ASELERIHYE GMDDVILLDF LPKELGFDMN       180
     MHILSFAPGA SHGYIETHVQ EHGAYILSGQ GVYNLDNNWI PVKKGDYIFM GAYSLQAGYG       240
     VGRGEAFSYI YSKDCNRDVE I                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page