(data stored in SCRATCH3701 zone)

EMBL: CP001396.YLCG

CP001396.YLCG        Location/Qualifiers
FT   CDS             475713..475853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylcG"
FT                   /locus_tag="BWG_0423"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /note="MG1655 equivalent: b4509"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62804"
FT                   /protein_id="ACR62804.1"
FT                   /translation="MMFEFNMAELLRHRWGRLRLYRFPGSVLTDYRILKNYAKTLTGAG
FT                   V"
     MMFEFNMAEL LRHRWGRLRL YRFPGSVLTD YRILKNYAKT LTGAGV                       46
//

If you have problems or comments...

PBIL Back to PBIL home page