(data stored in ACNUC7421 zone)

EMBL: CP001402.PE1

CP001402.PE1         Location/Qualifiers
FT   CDS             471..767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40637"
FT                   /db_xref="GOA:C4KJB7"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJB7"
FT                   /protein_id="ACR40637.1"
FT                   /translation="MVIRRMFIKSTLAVSFSISYLLYIIAKISFGSGKLAFIIALLQLY
FT                   PYFLIDYLPTVQVVSLFFQSLLLLLFAIFILLITYMLFLFYKLYKMVKTSILK"
     MVIRRMFIKS TLAVSFSISY LLYIIAKISF GSGKLAFIIA LLQLYPYFLI DYLPTVQVVS        60
     LFFQSLLLLL FAIFILLITY MLFLFYKLYK MVKTSILK                                98
//

If you have problems or comments...

PBIL Back to PBIL home page