(data stored in ACNUC7421 zone)

EMBL: CP001402.PE10

CP001402.PE10        Location/Qualifiers
FT   CDS             complement(7052..7336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40646"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC6"
FT                   /protein_id="ACR40646.1"
FT                   /translation="MKPAEYKKLIDMLTRRGFDVRENGEELLAIFYPPTIEEAGGEGEI
FT                   PNQRYYVIKFKIRNGLAYYDSTTLMENDKPIKVLNIDEVELWLESFLGE"
     MKPAEYKKLI DMLTRRGFDV RENGEELLAI FYPPTIEEAG GEGEIPNQRY YVIKFKIRNG        60
     LAYYDSTTLM ENDKPIKVLN IDEVELWLES FLGE                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page