(data stored in ACNUC7421 zone)

EMBL: CP001402.PE103

CP001402.PE103       Location/Qualifiers
FT   CDS             91026..92051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0103"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40739"
FT                   /db_xref="GOA:C4KJL9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL9"
FT                   /protein_id="ACR40739.1"
FT                   /translation="MERKQVFVRETSGLIKQVSLTDAVMLNLANMSIGIALFQSISPYI
FT                   TQGGVLWMASLIGMFLALPQALVYTIFNRKVGRTGGDYVWISRNLGGIIGTIFAVAYLL
FT                   EATAFYAIISFFSASSINSALLTIGYLNHQNTLIYVTENVIVNPYATPTLQQRLIFYGI
FT                   SALAFVIIVLINILHSKWGYKLVTSLGTFSILTIILAMIIIAINAKHFDSSVIPLLKDF
FT                   NVTVSSNLPKTILPYSISLPATLSLLPLFSLYTYPWMNAGPAVSSEFRGDKVSKFNVFF
FT                   SLLITGILVTLGFLEMDVVGGYYFNLNAYPSAIYNFWTVAMALSLNPMSVDNNFVHLKF
FT                   G"
     MERKQVFVRE TSGLIKQVSL TDAVMLNLAN MSIGIALFQS ISPYITQGGV LWMASLIGMF        60
     LALPQALVYT IFNRKVGRTG GDYVWISRNL GGIIGTIFAV AYLLEATAFY AIISFFSASS       120
     INSALLTIGY LNHQNTLIYV TENVIVNPYA TPTLQQRLIF YGISALAFVI IVLINILHSK       180
     WGYKLVTSLG TFSILTIILA MIIIAINAKH FDSSVIPLLK DFNVTVSSNL PKTILPYSIS       240
     LPATLSLLPL FSLYTYPWMN AGPAVSSEFR GDKVSKFNVF FSLLITGILV TLGFLEMDVV       300
     GGYYFNLNAY PSAIYNFWTV AMALSLNPMS VDNNFVHLKF G                           341
//

If you have problems or comments...

PBIL Back to PBIL home page