(data stored in ACNUC7421 zone)

EMBL: CP001402.PE104

CP001402.PE104       Location/Qualifiers
FT   CDS             complement(92341..93048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40740"
FT                   /db_xref="UniProtKB/TrEMBL:C4KG94"
FT                   /protein_id="ACR40740.1"
FT                   /translation="MGTMWKVPVLTQVILVLMEYINLSPRFYSKETVASALTNYVSGLS
FT                   SWRAVLPHSTLLYYHRRLSYVKYAVPLSGVYAIDEAKVRLTNGQYYYVWIVRDVKTKAI
FT                   PFFMITSVRSGVHVLVVLANMKRAEEVTRRIFKVRMDKVIYLHDGATAYNAFSWLNVEH
FT                   EKVMFNERDYAEQGFRSLKHRLASMDFHFPWNSNKFTLARWLSTFFLIYNILYTPTYLL
FT                   DKGVIINVNISNE"
     MGTMWKVPVL TQVILVLMEY INLSPRFYSK ETVASALTNY VSGLSSWRAV LPHSTLLYYH        60
     RRLSYVKYAV PLSGVYAIDE AKVRLTNGQY YYVWIVRDVK TKAIPFFMIT SVRSGVHVLV       120
     VLANMKRAEE VTRRIFKVRM DKVIYLHDGA TAYNAFSWLN VEHEKVMFNE RDYAEQGFRS       180
     LKHRLASMDF HFPWNSNKFT LARWLSTFFL IYNILYTPTY LLDKGVIINV NISNE            235
//

If you have problems or comments...

PBIL Back to PBIL home page