(data stored in ACNUC7421 zone)

EMBL: CP001402.PE105

CP001402.PE105       Location/Qualifiers
FT   CDS             93160..93735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0105"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40741"
FT                   /db_xref="GOA:C4KJM1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM1"
FT                   /protein_id="ACR40741.1"
FT                   /translation="MLSTLNPIIEWILGLGLILWNYFVLSYGVLVFSRYVFALSFDRVF
FT                   PEKLSQLNAHGSPVYAHLLDITLTLLFLLIPVFSIDAAISLYGASIVGMLYFLAVGISA
FT                   IIFGQKTKSRLMKIAGILTTIYFVYLTYEAATNPLFGFSTTSGVNIITLSFVLGSFVSG
FT                   IIIWSVTKYMNLKKGIDLSLTFKEIPPE"
     MLSTLNPIIE WILGLGLILW NYFVLSYGVL VFSRYVFALS FDRVFPEKLS QLNAHGSPVY        60
     AHLLDITLTL LFLLIPVFSI DAAISLYGAS IVGMLYFLAV GISAIIFGQK TKSRLMKIAG       120
     ILTTIYFVYL TYEAATNPLF GFSTTSGVNI ITLSFVLGSF VSGIIIWSVT KYMNLKKGID       180
     LSLTFKEIPP E                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page