(data stored in ACNUC7421 zone)

EMBL: CP001402.PE106

CP001402.PE106       Location/Qualifiers
FT   CDS             complement(93706..94095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0106"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40742"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM2"
FT                   /protein_id="ACR40742.1"
FT                   /translation="MNLEPLFQRANELLRASKFNFNSGFYEIAAIAAEESLYLMLNATL
FT                   IKLGADIPWYLDFDVLFRVISRYSHDDRLSEIRIKERDIIRLLDDIKIRLGYSIPLELN
FT                   EKDIEKLIAFSEKMFDLLWRNFLKS"
     MNLEPLFQRA NELLRASKFN FNSGFYEIAA IAAEESLYLM LNATLIKLGA DIPWYLDFDV        60
     LFRVISRYSH DDRLSEIRIK ERDIIRLLDD IKIRLGYSIP LELNEKDIEK LIAFSEKMFD       120
     LLWRNFLKS                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page