(data stored in ACNUC7421 zone)

EMBL: CP001402.PE107

CP001402.PE107       Location/Qualifiers
FT   CDS             complement(94143..94547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0107"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40743"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM3"
FT                   /protein_id="ACR40743.1"
FT                   /translation="MENIEYVFEDVVRIYDTDAQGIAHYAAYYRFFTNTIEKFIKEKVG
FT                   IPYPIVNDDLWFVIAESHAIYRKPVKLGDRLTILLNPKILSNKTIKFDFRILRDGELTT
FT                   EGYLIQIAINPKIWKSTEMPKEIMDKLSIK"
     MENIEYVFED VVRIYDTDAQ GIAHYAAYYR FFTNTIEKFI KEKVGIPYPI VNDDLWFVIA        60
     ESHAIYRKPV KLGDRLTILL NPKILSNKTI KFDFRILRDG ELTTEGYLIQ IAINPKIWKS       120
     TEMPKEIMDK LSIK                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page