(data stored in ACNUC7421 zone)

EMBL: CP001402.PE108

CP001402.PE108       Location/Qualifiers
FT   CDS             complement(94597..95280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0108"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40744"
FT                   /db_xref="GOA:C4KJM4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM4"
FT                   /protein_id="ACR40744.1"
FT                   /translation="MRVSEIPVYIIGVGPGDPEYLTLKGYKAIKDSSIVAGWKSVLERF
FT                   WPILEGKRTVVLTYKKESETLEEIIEIGKTENVAILDHGDPSVSDWQFVEKIRNIATSK
FT                   GVKVNIISGVSSLNIALSRLGLDINFIGFVTLHVRGDISKSLNDLLNILKMGRVAVVIP
FT                   EPYKDGPQKVAKFLYDNNLNCRIVVFEKLSYDDERRRDYDNLISLLNENNEFGDLTIMA
FT                   IFPKS"
     MRVSEIPVYI IGVGPGDPEY LTLKGYKAIK DSSIVAGWKS VLERFWPILE GKRTVVLTYK        60
     KESETLEEII EIGKTENVAI LDHGDPSVSD WQFVEKIRNI ATSKGVKVNI ISGVSSLNIA       120
     LSRLGLDINF IGFVTLHVRG DISKSLNDLL NILKMGRVAV VIPEPYKDGP QKVAKFLYDN       180
     NLNCRIVVFE KLSYDDERRR DYDNLISLLN ENNEFGDLTI MAIFPKS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page