(data stored in ACNUC7421 zone)

EMBL: CP001402.PE109

CP001402.PE109       Location/Qualifiers
FT   CDS             complement(95267..96256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0109"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40745"
FT                   /db_xref="GOA:C4KJM5"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM5"
FT                   /protein_id="ACR40745.1"
FT                   /translation="MIENLWRGIAIISASEDGFKAGEIVKEKLKRFEIPVVHFKYKDAD
FT                   IETVWRCYDAIIFVMALEGATRIICKYAKSKTEDPAIICIDDKINYVIPLLGGHWGAND
FT                   IARDLSVILNSTPIITTAAELKGKLSVEKIANILVAKILNPENIVKINAVLLRDEYVCV
FT                   DGVDINVTFPENIRINSEECNYIVSLRNDKEYKDKIVVWLKPLKISIGVGSKKDVKIDE
FT                   IRDGIYKVLERLNLKRERIGIIASIREEVKKIADEINVKFRLVNEEEINNFTNPCLTPP
FT                   SKTLIEVGLKGVAEISALIAGGINSKLILRKIAISRNSTIAVATYEGE"
     MIENLWRGIA IISASEDGFK AGEIVKEKLK RFEIPVVHFK YKDADIETVW RCYDAIIFVM        60
     ALEGATRIIC KYAKSKTEDP AIICIDDKIN YVIPLLGGHW GANDIARDLS VILNSTPIIT       120
     TAAELKGKLS VEKIANILVA KILNPENIVK INAVLLRDEY VCVDGVDINV TFPENIRINS       180
     EECNYIVSLR NDKEYKDKIV VWLKPLKISI GVGSKKDVKI DEIRDGIYKV LERLNLKRER       240
     IGIIASIREE VKKIADEINV KFRLVNEEEI NNFTNPCLTP PSKTLIEVGL KGVAEISALI       300
     AGGINSKLIL RKIAISRNST IAVATYEGE                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page