(data stored in ACNUC7421 zone)

EMBL: CP001402.PE112

CP001402.PE112       Location/Qualifiers
FT   CDS             complement(97718..98317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0112"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40748"
FT                   /db_xref="GOA:C4KJM8"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJM8"
FT                   /protein_id="ACR40748.1"
FT                   /translation="MEWKYVIPGIPDNFFERDEEIPMTKEEIRALALSKLRIRKGDMIL
FT                   DIGCGTGSVTVEASLLVGSTGKVYGVDKEEKAINLTRRNAEKFGVLNNIVLIKGEAPEI
FT                   LFTINEKFDRIFIGGGSEKIKEIISASWEIIKKGGRVVIDAILLETVNNAISAMENIGF
FT                   MNLEITEVIIAKGMKTKVGTAMMTRNPIFIISGEKQ"
     MEWKYVIPGI PDNFFERDEE IPMTKEEIRA LALSKLRIRK GDMILDIGCG TGSVTVEASL        60
     LVGSTGKVYG VDKEEKAINL TRRNAEKFGV LNNIVLIKGE APEILFTINE KFDRIFIGGG       120
     SEKIKEIISA SWEIIKKGGR VVIDAILLET VNNAISAMEN IGFMNLEITE VIIAKGMKTK       180
     VGTAMMTRNP IFIISGEKQ                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page