(data stored in ACNUC7421 zone)

EMBL: CP001402.PE113

CP001402.PE113       Location/Qualifiers
FT   CDS             complement(98318..99367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0113"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40749"
FT                   /db_xref="GOA:C4KJM9"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJM9"
FT                   /protein_id="ACR40749.1"
FT                   /translation="MIINSLKRFGITTGAAASAAAKAAVIGLLNREKRNTVVIPTPIGL
FT                   RLEIPVEKVEIDSGIACAEVKKFSGDNPDILDGLAIRCCAKLNESNEIVIVGGKGVGKV
FT                   TRSGLKATMGETAISPTVRDMVINAIREVTDKGIQITIEVPNGDIIAENTLNKMVGIVG
FT                   GISILGTTGIETPVSDDDYLEHIKCELNVIRQSYDFVVIAPGNSAAKYASKLFDSNSII
FT                   KVGDRIGDSIKLASSVFRKVILAGLPAKLLKVYAGIFNTHFSQGDARLESLTHASVLAG
FT                   LPYDVLTKITNALSVEEAFTYMTKEQRRKVMKIVAEKILSRIKSFNGDINFCVIIFDYD
FT                   GESLSRVGC"
     MIINSLKRFG ITTGAAASAA AKAAVIGLLN REKRNTVVIP TPIGLRLEIP VEKVEIDSGI        60
     ACAEVKKFSG DNPDILDGLA IRCCAKLNES NEIVIVGGKG VGKVTRSGLK ATMGETAISP       120
     TVRDMVINAI REVTDKGIQI TIEVPNGDII AENTLNKMVG IVGGISILGT TGIETPVSDD       180
     DYLEHIKCEL NVIRQSYDFV VIAPGNSAAK YASKLFDSNS IIKVGDRIGD SIKLASSVFR       240
     KVILAGLPAK LLKVYAGIFN THFSQGDARL ESLTHASVLA GLPYDVLTKI TNALSVEEAF       300
     TYMTKEQRRK VMKIVAEKIL SRIKSFNGDI NFCVIIFDYD GESLSRVGC                   349
//

If you have problems or comments...

PBIL Back to PBIL home page