(data stored in ACNUC7421 zone)

EMBL: CP001402.PE116

CP001402.PE116       Location/Qualifiers
FT   CDS             complement(102030..103064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0116"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40752"
FT                   /db_xref="GOA:C4KJN2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022563"
FT                   /db_xref="InterPro:IPR023863"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN2"
FT                   /protein_id="ACR40752.1"
FT                   /translation="MSTLKPMIVGNVKRALLGLGVRKLPLIAGHKLLYTCNLRCRMCPF
FT                   WRRKDEKLLSLEEEVLMLKSLERAGVLFMGFEGGEPLLRRDLEQILEESYKRFYTSLVT
FT                   NGWLLKDRVKSISENLDYLFVSIDGIDEVHDKIRGISGAFERAVEGIKEARKYLPVAIS
FT                   FTITRENMDQVKDVIELAQKLNVKISIQVEYDYSTAEKLSPDKRRLYDTLRLIIELKKR
FT                   GYPIVESVDYFEAIVNSWYNKMPWKCKPWLTINIDPQGRIVLPCYVLNEYSGTDKAWEV
FT                   NIVKLWNTYPWEKYENCNACALACYLEPSLFSWSNGKMVKEKIIDNMASYLYNAILVKF
FT                   LLSR"
     MSTLKPMIVG NVKRALLGLG VRKLPLIAGH KLLYTCNLRC RMCPFWRRKD EKLLSLEEEV        60
     LMLKSLERAG VLFMGFEGGE PLLRRDLEQI LEESYKRFYT SLVTNGWLLK DRVKSISENL       120
     DYLFVSIDGI DEVHDKIRGI SGAFERAVEG IKEARKYLPV AISFTITREN MDQVKDVIEL       180
     AQKLNVKISI QVEYDYSTAE KLSPDKRRLY DTLRLIIELK KRGYPIVESV DYFEAIVNSW       240
     YNKMPWKCKP WLTINIDPQG RIVLPCYVLN EYSGTDKAWE VNIVKLWNTY PWEKYENCNA       300
     CALACYLEPS LFSWSNGKMV KEKIIDNMAS YLYNAILVKF LLSR                        344
//

If you have problems or comments...

PBIL Back to PBIL home page