(data stored in ACNUC7421 zone)

EMBL: CP001402.PE117

CP001402.PE117       Location/Qualifiers
FT   CDS             103058..103957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0117"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40753"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN3"
FT                   /protein_id="ACR40753.1"
FT                   /translation="MTYLINIQTHVLIFCEKLNITDFVSQVMPTVKLTKNITVMTGSPN
FT                   TLIYDNRVVIDLGGKNSSLDLNAEVQLATHGHADHIAGLLKKDAKIRYLPKEDYWSLTL
FT                   MGRRAMIYGCSSKDSEIFIFDYVKENLDSLNNEIRNSEIEVVKLPGHTPGHSGYIVHNV
FT                   LYAGDAFFGEKVLESFSVPFYTDFWAALESLDKVKELAKSVDNIVISHGPVYTNKNKMV
FT                   SILESNITYAQKLIGKILDLLSNSAFTVEEIVVKLKQDLTPANVLLNSVVVRSILLGLE
FT                   NIEYNITQKGLVFRRKVH"
     MTYLINIQTH VLIFCEKLNI TDFVSQVMPT VKLTKNITVM TGSPNTLIYD NRVVIDLGGK        60
     NSSLDLNAEV QLATHGHADH IAGLLKKDAK IRYLPKEDYW SLTLMGRRAM IYGCSSKDSE       120
     IFIFDYVKEN LDSLNNEIRN SEIEVVKLPG HTPGHSGYIV HNVLYAGDAF FGEKVLESFS       180
     VPFYTDFWAA LESLDKVKEL AKSVDNIVIS HGPVYTNKNK MVSILESNIT YAQKLIGKIL       240
     DLLSNSAFTV EEIVVKLKQD LTPANVLLNS VVVRSILLGL ENIEYNITQK GLVFRRKVH        299
//

If you have problems or comments...

PBIL Back to PBIL home page