(data stored in ACNUC7421 zone)

EMBL: CP001402.PE118

CP001402.PE118       Location/Qualifiers
FT   CDS             complement(104257..105678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0118"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40754"
FT                   /db_xref="GOA:C4KJN4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN4"
FT                   /protein_id="ACR40754.1"
FT                   /translation="MPRIFSIKNEVDSKYIFMLAFMLALFSSGVPPEIVILHLSREDTF
FT                   EPYTKVFKKIRNLVSGYRYKFSSAITYSIKNLNIRYLKEFLIRLSQAVTFGDDMIESLS
FT                   REIDFTLSEYNAYSARLIESMNNFLTIYATLNSSLTFLVADITILSLIYSGGTTLITQL
FT                   TILSLALLGNLTLVMYLLYRPENYIRYNVIDKLLLTLAISLSIIFSIIYTSYIVLMVTG
FT                   IVLLGVGLRYRIYENKINRIERHFLLFIRYFSRNYAIVSNLKESLMAVLRGDLGDVKPL
FT                   IKRSLNRLNFGINKEKIFRLIGDESGSVLVSMLSKVLYETISMGGNVMIIGEILSKIGD
FT                   SVLNIRSRKEQNGRAFETSIYALQTASAGVSAALISIVGMLNNIFSTQNVSTVFSFSEV
FT                   NIDMISRIFLIILLILSFTNGIAITLAYGKSLYVSLYFIGILIILSSISYHIVLILTGN
FT                   IFKELVSPSGLLQTT"
     MPRIFSIKNE VDSKYIFMLA FMLALFSSGV PPEIVILHLS REDTFEPYTK VFKKIRNLVS        60
     GYRYKFSSAI TYSIKNLNIR YLKEFLIRLS QAVTFGDDMI ESLSREIDFT LSEYNAYSAR       120
     LIESMNNFLT IYATLNSSLT FLVADITILS LIYSGGTTLI TQLTILSLAL LGNLTLVMYL       180
     LYRPENYIRY NVIDKLLLTL AISLSIIFSI IYTSYIVLMV TGIVLLGVGL RYRIYENKIN       240
     RIERHFLLFI RYFSRNYAIV SNLKESLMAV LRGDLGDVKP LIKRSLNRLN FGINKEKIFR       300
     LIGDESGSVL VSMLSKVLYE TISMGGNVMI IGEILSKIGD SVLNIRSRKE QNGRAFETSI       360
     YALQTASAGV SAALISIVGM LNNIFSTQNV STVFSFSEVN IDMISRIFLI ILLILSFTNG       420
     IAITLAYGKS LYVSLYFIGI LIILSSISYH IVLILTGNIF KELVSPSGLL QTT              473
//

If you have problems or comments...

PBIL Back to PBIL home page