(data stored in ACNUC7421 zone)

EMBL: CP001402.PE120

CP001402.PE120       Location/Qualifiers
FT   CDS             complement(107206..107910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0120"
FT                   /product="flagellar accessory protein FlaH"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40756"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK15"
FT                   /protein_id="ACR40756.1"
FT                   /translation="MEGCTVIIKTGNEDLDRRLSGIPFPALIMIEGDHGTGKSVLSAQF
FT                   CYGLLIGGKKGYVITTEQTSKDYLKKMKDVKINLIPFFLKGVLGIAPLNTNRFNWNSTL
FT                   ANKILEVIIDFIKKRKNMDFVIIDSLSIVATFAEIKQILQFMKDARVLVDLGKLILFTV
FT                   HPDVFNEELKSRITSIVDVYFKLSATSIGGRRIKVLERIKTIGGIQGADAISFDIDPAL
FT                   GVKVVPLSLSRA"
     MEGCTVIIKT GNEDLDRRLS GIPFPALIMI EGDHGTGKSV LSAQFCYGLL IGGKKGYVIT        60
     TEQTSKDYLK KMKDVKINLI PFFLKGVLGI APLNTNRFNW NSTLANKILE VIIDFIKKRK       120
     NMDFVIIDSL SIVATFAEIK QILQFMKDAR VLVDLGKLIL FTVHPDVFNE ELKSRITSIV       180
     DVYFKLSATS IGGRRIKVLE RIKTIGGIQG ADAISFDIDP ALGVKVVPLS LSRA             234
//

If you have problems or comments...

PBIL Back to PBIL home page