(data stored in ACNUC7421 zone)

EMBL: CP001402.PE121

CP001402.PE121       Location/Qualifiers
FT   CDS             complement(107892..108380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40757"
FT                   /db_xref="GOA:C4KK16"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK16"
FT                   /protein_id="ACR40757.1"
FT                   /translation="MGVSQVVAYVLLFFITISLGLIALGAYIKSQQFLLHAEDMRQNMD
FT                   LNQLNTRIFIKSVAINGYLLYMTITNNGSTVLYDFKDFAIIIKYYANVSNVSTLIISNY
FT                   NYSTSLGPYKWVSNTVLINPNMVGTFIADLPYPPYPNTEATVVVVSNYGPEAIWRGVL"
     MGVSQVVAYV LLFFITISLG LIALGAYIKS QQFLLHAEDM RQNMDLNQLN TRIFIKSVAI        60
     NGYLLYMTIT NNGSTVLYDF KDFAIIIKYY ANVSNVSTLI ISNYNYSTSL GPYKWVSNTV       120
     LINPNMVGTF IADLPYPPYP NTEATVVVVS NYGPEAIWRG VL                          162
//

If you have problems or comments...

PBIL Back to PBIL home page