(data stored in ACNUC7421 zone)

EMBL: CP001402.PE122

CP001402.PE122       Location/Qualifiers
FT   CDS             complement(108383..108850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0122"
FT                   /product="putative flagellar protein FlaG"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40758"
FT                   /db_xref="GOA:C4KK17"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK17"
FT                   /protein_id="ACR40758.1"
FT                   /translation="MASEVISETIMLIVAVTLVGVVAGSVFSVVSSISTNMVSYSILQS
FT                   QKLVTDLQIDYATNASSTTVIVYLHNIGESTIFNLKNSVLYFGPQGNLQQIGYNSSSTL
FT                   PYWVVNTNTLYPGSVAKIIIYLSSPLSTTQYYTVQLVTPNGYSVSYTFEAS"
     MASEVISETI MLIVAVTLVG VVAGSVFSVV SSISTNMVSY SILQSQKLVT DLQIDYATNA        60
     SSTTVIVYLH NIGESTIFNL KNSVLYFGPQ GNLQQIGYNS SSTLPYWVVN TNTLYPGSVA       120
     KIIIYLSSPL STTQYYTVQL VTPNGYSVSY TFEAS                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page