(data stored in ACNUC7421 zone)

EMBL: CP001402.PE123

CP001402.PE123       Location/Qualifiers
FT   CDS             complement(108843..109604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40759"
FT                   /db_xref="GOA:C4KK18"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK18"
FT                   /protein_id="ACR40759.1"
FT                   /translation="MINLNLLELQQLMESPLFILLISISIPLAAFFISFFKIVFPRITR
FT                   PKNTQPPQTASTTQQNQQQQQITTNSSKEIEELLKNLINRMDKYQSDLVNVLNGSMEDL
FT                   KQTLQKLNSSIEDAVLSLKSAQADSSSPFNIISEQSKGEQRPEGNKELKAVAEIVGTSN
FT                   IDLSTFIRNCVLLEILDYDDSKLTALYELGYISADDMFIVNKVQSYIRTNSGKIRAKDL
FT                   ANIAMNVAESYSSVTAEMKKYLLVLEVGKNG"
     MINLNLLELQ QLMESPLFIL LISISIPLAA FFISFFKIVF PRITRPKNTQ PPQTASTTQQ        60
     NQQQQQITTN SSKEIEELLK NLINRMDKYQ SDLVNVLNGS MEDLKQTLQK LNSSIEDAVL       120
     SLKSAQADSS SPFNIISEQS KGEQRPEGNK ELKAVAEIVG TSNIDLSTFI RNCVLLEILD       180
     YDDSKLTALY ELGYISADDM FIVNKVQSYI RTNSGKIRAK DLANIAMNVA ESYSSVTAEM       240
     KKYLLVLEVG KNG                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page