(data stored in ACNUC7421 zone)

EMBL: CP001402.PE128

CP001402.PE128       Location/Qualifiers
FT   CDS             113185..113994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40764"
FT                   /db_xref="GOA:C4KK23"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK23"
FT                   /protein_id="ACR40764.1"
FT                   /translation="MSYNVFDILRELDSIVDFARAKLQWDILFFINSKGPSSVSEIAEG
FT                   TNNSKKAVIDAIRKLIEKELIIKIKYDVYDLSDKGKQVLNKLNSFTSNTVPSQNDADHG
FT                   NNTLSNMDNPSQNFYLLELIKISLLNNGILPIDKAYRELGISKQTLKYYLELFMQKKIF
FT                   KKVNKKNFLGRNIQSAVLTSEGRKIAYRVPSLIKIRNNLFLRLLLKMTFSISYESALLK
FT                   LMVFFALSSPIIIYYDGDAPIRMIGILWLYMLVFTSLLSVFAYLTMR"
     MSYNVFDILR ELDSIVDFAR AKLQWDILFF INSKGPSSVS EIAEGTNNSK KAVIDAIRKL        60
     IEKELIIKIK YDVYDLSDKG KQVLNKLNSF TSNTVPSQND ADHGNNTLSN MDNPSQNFYL       120
     LELIKISLLN NGILPIDKAY RELGISKQTL KYYLELFMQK KIFKKVNKKN FLGRNIQSAV       180
     LTSEGRKIAY RVPSLIKIRN NLFLRLLLKM TFSISYESAL LKLMVFFALS SPIIIYYDGD       240
     APIRMIGILW LYMLVFTSLL SVFAYLTMR                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page