(data stored in ACNUC7421 zone)

EMBL: CP001402.PE129

CP001402.PE129       Location/Qualifiers
FT   CDS             114008..114493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40765"
FT                   /db_xref="GOA:C4KK24"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK24"
FT                   /protein_id="ACR40765.1"
FT                   /translation="MELANVSLLYLITGNYTHYLMLITILNVSKNFAIINMTEISHNIT
FT                   LSYVVAYPIFLLYVPNVTQQSTVTQFEGINTTILNIRNFTIYVDVYNGIVIHYIGHGIN
FT                   ATLIGATIPLGPGVYKLIPSYMLGHQRNNNVEEYETVLLTIVLVVSFYIIFERMDKK"
     MELANVSLLY LITGNYTHYL MLITILNVSK NFAIINMTEI SHNITLSYVV AYPIFLLYVP        60
     NVTQQSTVTQ FEGINTTILN IRNFTIYVDV YNGIVIHYIG HGINATLIGA TIPLGPGVYK       120
     LIPSYMLGHQ RNNNVEEYET VLLTIVLVVS FYIIFERMDK K                           161
//

If you have problems or comments...

PBIL Back to PBIL home page