(data stored in ACNUC7421 zone)

EMBL: CP001402.PE132

CP001402.PE132       Location/Qualifiers
FT   CDS             116308..117036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK27"
FT                   /protein_id="ACR40768.1"
FT                   /translation="MGAIYVLGVKGGIGKTTFSLYFAKRLSLMGKKVMYIDHDYFSFGC
FT                   LILGHNDLGLLEEIERNLPIFSRSLKNIDNLYVLKLFSNPLNINKNYSLLSNKIPQVLN
FT                   SILKREVDYIILDSSVGILPDNDIVMALLEELEIEKEGVFLSDMLSVNSTIKYAKLWEN
FT                   NIKYKVLVINMVPPIPENLSEAIKIANEVYNNYKELFNAAIVVQFDEKMYNYNPIIAEY
FT                   ENEKLNSILLSILYRYNTLK"
     MGAIYVLGVK GGIGKTTFSL YFAKRLSLMG KKVMYIDHDY FSFGCLILGH NDLGLLEEIE        60
     RNLPIFSRSL KNIDNLYVLK LFSNPLNINK NYSLLSNKIP QVLNSILKRE VDYIILDSSV       120
     GILPDNDIVM ALLEELEIEK EGVFLSDMLS VNSTIKYAKL WENNIKYKVL VINMVPPIPE       180
     NLSEAIKIAN EVYNNYKELF NAAIVVQFDE KMYNYNPIIA EYENEKLNSI LLSILYRYNT       240
     LK                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page