(data stored in ACNUC7421 zone)

EMBL: CP001402.PE133

CP001402.PE133       Location/Qualifiers
FT   CDS             117297..118064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40769"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK28"
FT                   /protein_id="ACR40769.1"
FT                   /translation="MIRINVVGFKGGSGKSTVSYYLARQLSEYYNVVLVDKTYSGTISR
FT                   IYNINNNIFSFLKGRNELFYVSKNSFSVINMSFSSENDLNNFDFNTFKYLYGKLIKDSD
FT                   IVVVDHSSIPHDFATEIELKAFMENFKNFAYNTVLVLSGDEIPIKRYLNYTTLLNDFVK
FT                   NYAEKILGISLPRDVKFLKIIAVIINKILKGQESKLEEFIRGDEILQRSARFVIPFYLS
FT                   LTQRHFKDIEPPKEIIDIVRYILDLLREPTSIL"
     MIRINVVGFK GGSGKSTVSY YLARQLSEYY NVVLVDKTYS GTISRIYNIN NNIFSFLKGR        60
     NELFYVSKNS FSVINMSFSS ENDLNNFDFN TFKYLYGKLI KDSDIVVVDH SSIPHDFATE       120
     IELKAFMENF KNFAYNTVLV LSGDEIPIKR YLNYTTLLND FVKNYAEKIL GISLPRDVKF       180
     LKIIAVIINK ILKGQESKLE EFIRGDEILQ RSARFVIPFY LSLTQRHFKD IEPPKEIIDI       240
     VRYILDLLRE PTSIL                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page