(data stored in ACNUC7421 zone)

EMBL: CP001402.PE134

CP001402.PE134       Location/Qualifiers
FT   CDS             complement(118059..119054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0136"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40770"
FT                   /db_xref="GOA:C4KK29"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK29"
FT                   /protein_id="ACR40770.1"
FT                   /translation="MKALVFDKSGLENLKVKEVQEPQLGPHDVLIRVVKSGLNPIDYFV
FT                   ISAIPVTPMPHIPGVEVAGIVEKVGDHVKGLAKGDKVVVYNRVFDGTCDLCLSGKEMLC
FT                   RNGGIMSVITNGGWSEYFSVPDKNVFKIPENMSWDIAASLPVAALTSYHSLKELKVSPN
FT                   DFVVIFGAGGNTGIFAVQLAKKFGATVIAVSRKNWLKDFGADYIIGYDDIVQKVKEITN
FT                   GKMADIVMNSLGSSVWEKSLEVLGLSGQLAFFGGLTGSEVKVNLSSLYGKHIKVVGTTG
FT                   GSRKELTELINICKDCKVKVHKTYRLDEGIEAVKQIMTENRDGRIMLQVS"
     MKALVFDKSG LENLKVKEVQ EPQLGPHDVL IRVVKSGLNP IDYFVISAIP VTPMPHIPGV        60
     EVAGIVEKVG DHVKGLAKGD KVVVYNRVFD GTCDLCLSGK EMLCRNGGIM SVITNGGWSE       120
     YFSVPDKNVF KIPENMSWDI AASLPVAALT SYHSLKELKV SPNDFVVIFG AGGNTGIFAV       180
     QLAKKFGATV IAVSRKNWLK DFGADYIIGY DDIVQKVKEI TNGKMADIVM NSLGSSVWEK       240
     SLEVLGLSGQ LAFFGGLTGS EVKVNLSSLY GKHIKVVGTT GGSRKELTEL INICKDCKVK       300
     VHKTYRLDEG IEAVKQIMTE NRDGRIMLQV S                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page