(data stored in ACNUC7421 zone)

EMBL: CP001402.PE135

CP001402.PE135       Location/Qualifiers
FT   CDS             complement(119104..119469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40771"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK30"
FT                   /protein_id="ACR40771.1"
FT                   /translation="MLMSVIEKFVKHIEKVYDNEEVRMLENLWMKKITNFPINLQVVEE
FT                   EDGEKLHLFVLKGAEAILLHKSTSIFLYITNLTSVELETLRYITIKKKGEEADEDFVSL
FT                   AYEYISFKNKAKIGIRQ"
     MLMSVIEKFV KHIEKVYDNE EVRMLENLWM KKITNFPINL QVVEEEDGEK LHLFVLKGAE        60
     AILLHKSTSI FLYITNLTSV ELETLRYITI KKKGEEADED FVSLAYEYIS FKNKAKIGIR       120
     Q                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page