(data stored in ACNUC7421 zone)

EMBL: CP001402.PE136

CP001402.PE136       Location/Qualifiers
FT   CDS             119551..120162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40772"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK31"
FT                   /protein_id="ACR40772.1"
FT                   /translation="MTTNIVRVLSIKGGVGKSSIAYALTRTISASGYKVLFLDMDNLHT
FT                   ISRVLGVKDCELTYVRDFFVFACDDFSKISFTNYEYVIIDTYSGISTETLSVIKGDLIY
FT                   NIFISDFSSIDNSLSYIKEWNGKRSINFLVVNMVIVEDNEYDILLRKFFDSLALKSNVK
FT                   INKVFLFFFDENYYGSYKVDLNHIELLASYVLGGIGESDP"
     MTTNIVRVLS IKGGVGKSSI AYALTRTISA SGYKVLFLDM DNLHTISRVL GVKDCELTYV        60
     RDFFVFACDD FSKISFTNYE YVIIDTYSGI STETLSVIKG DLIYNIFISD FSSIDNSLSY       120
     IKEWNGKRSI NFLVVNMVIV EDNEYDILLR KFFDSLALKS NVKINKVFLF FFDENYYGSY       180
     KVDLNHIELL ASYVLGGIGE SDP                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page